PLG Antikörper (Middle Region)

Produktnummer ABIN633957

Dieser Anti-PLG Antikörper ist ein Kaninchen Polyklonal Antikörper zur Detektion von PLG in WB. Geeignet für Human. Dieses Primary Antibody wurde in 2+ Publikationen zitiert.

Kurzübersicht für PLG Antikörper (Middle Region) (ABIN633957)

Target: PLG (Plasminogen (PLG))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser PLG Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-PLG Antikörper

Bindungsspezifität: Middle Region

Spezifität: Plasminogen antibody was raised against the middle region of PLG

Aufreinigung: Affinity purified

Immunogen: Plasminogen antibody was raised using the middle region of PLG corresponding to a region with amino acids LISPEWVLTAAHCLEKSPRPSSYKVILGAHQEVNLEPHVQEIEVSRLFLE

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

Plasminogen Blocking Peptide, (ABIN940452), is also available for use as a blocking control in assays to test for specificity of this Plasminogen antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PLG antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Referenzen für anti-PLG Antikörper (ABIN633957)

Giraud, Chabaud, Lejeune, Barbaria, Mallet: "The plasminogen-like molecule apically secreted by epithelial thyroid cells is sulfated." in: Biochemical and biophysical research communications, Vol. 346, Issue 3, pp. 746-50, (2006) (PubMed).

Giraud, Dicristofaro, De Micco, Lejeune, Barbaria, Mallet: "A plasminogen-like protein, present in the apical extracellular environment of thyroid epithelial cells, degrades thyroglobulin in vitro." in: Biochemical and biophysical research communications, Vol. 338, Issue 2, pp. 1000-4, (2005) (PubMed).

Details zu PLG

Target: PLG (Plasminogen (PLG))

Andere Bezeichnung: Plasminogen

Hintergrund: The protein encoded by this gene is a secreted blood zymogen that is activated by proteolysis and converted to plasmin and angiostatin.

Molekulargewicht: 88 kDa (MW of target protein)

Pathways: Komplementsystem, Lipid Metabolism